PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN44700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 352aa    MW: 40286.1 Da    PI: 10.0115
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN44700.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.21.3e-15453148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     r+rW +eEd ll  +vkq+G++ W++++++m+  ++R +k+c +rw +yl
       KHN44700.1  4 RQRWRAEEDALLCSYVKQYGPREWNLVSQRMNtpLNRDAKSCLERWKNYL 53
                     89**********************************************97 PP

2Myb_DNA-binding35.62.1e-1159103147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ T+eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
       KHN44700.1  59 KGSLTEEEQRLVIRLQAKYGNK-WKKIAAEVP-GRTAKRLGKWWEVF 103
                      6788******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.196153IPR017930Myb domain
SMARTSM007178.5E-13355IPR001005SANT/Myb domain
SuperFamilySSF466893.07E-21498IPR009057Homeodomain-like
CDDcd001675.33E-8653No hitNo description
Gene3DG3DSA:1.10.10.608.0E-21660IPR009057Homeodomain-like
PfamPF139216.9E-15767No hitNo description
PROSITE profilePS5129423.78654108IPR017930Myb domain
SMARTSM007172.4E-1058106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-1561102IPR009057Homeodomain-like
CDDcd001673.07E-763104No hitNo description
Gene3DG3DSA:3.30.70.3607.3E-4258339IPR011650Peptidase M20, dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MKERQRWRAE EDALLCSYVK QYGPREWNLV SQRMNTPLNR DAKSCLERWK NYLKPDIKKG  60
SLTEEEQRLV IRLQAKYGNK WKKIAAEVPG RTAKRLGKWW EVFKEKQQRE KKDVNRISDP  120
INNSKYEHIL ESFAEKLVKE RPSPSFLMAA SNGAFLHTDT PAPASSLLPS WLSNSSSPAA  180
DGPSSLSVTL SLSSSMVIAP PFSWLPPKRG PDNAPFVLGN AAALQGVIPT LSDNMLMSQM  240
VEHRKELEEG HRALGTHKKE AAWRLSRVEL QLESEKTNRR REKIEEFEAK IKALQEEELA  300
ALGRIEAEYR EQLDALRRDA ENKEQKLAEQ WAAKHLRLTR LLEQLGCRAG LP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C2e-17792789C-Myb DNA-Binding Domain
1mse_C2e-17792789C-Myb DNA-Binding Domain
1gv2_A2e-17792789MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7378430.0KC737843.1 Glycine max PHAN4 (PHAN4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001304446.10.0transcription factor AS1-like
RefseqXP_014626727.10.0PREDICTED: transcription factor AS1-like
RefseqXP_014626726.10.0PREDICTED: transcription factor AS1-like
RefseqXP_014626725.10.0PREDICTED: transcription factor AS1-like
SwissprotO809311e-141AS1_ARATH; Transcription factor AS1
TrEMBLA0A0B2SI540.0A0A0B2SI54_GLYSO; Transcription factor AS1
TrEMBLI1N1S30.0I1N1S3_SOYBN; PHAN4
STRINGGLYMA18G26600.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25973369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.11e-120MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]